| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
| Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species) |
| Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (27 PDB entries) |
| Domain d1i7ra2: 1i7r A:1-181 [66051] Other proteins in same PDB: d1i7ra1, d1i7rb_, d1i7rd1, d1i7re_ |
PDB Entry: 1i7r (more details), 2.2 Å
SCOP Domain Sequences for d1i7ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7ra2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r
Timeline for d1i7ra2:
View in 3DDomains from other chains: (mouse over for more information) d1i7rb_, d1i7rd1, d1i7rd2, d1i7re_ |