![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.1: Reductases [52344] (5 proteins) |
![]() | Protein cytochrome b5 reductase [52357] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [69450] (3 PDB entries) Uniprot P20070 33-300 |
![]() | Domain d1i7pa2: 1i7p A:154-300 [66049] Other proteins in same PDB: d1i7pa1, d1i7pa3 complexed with fad |
PDB Entry: 1i7p (more details), 2 Å
SCOPe Domain Sequences for d1i7pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7pa2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]} gkfairadkksnpvvrtvksvgmiaggtgitpmlqviravlkdpndhtvcyllfanqsek dillrpeleelrnehssrfklwytvdkapdawdysqgfvneemirdhlpppgeetlilmc gpppmiqfaclpnlervghpkercftf
Timeline for d1i7pa2: