Lineage for d1i7pa1 (1i7p A:33-153)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793526Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2793531Protein cytochrome b5 reductase [50427] (3 species)
  7. 2793534Species Norway rat (Rattus norvegicus) [TaxId:10116] [69273] (3 PDB entries)
    Uniprot P20070 33-300
  8. 2793537Domain d1i7pa1: 1i7p A:33-153 [66048]
    Other proteins in same PDB: d1i7pa2, d1i7pa3
    complexed with fad

Details for d1i7pa1

PDB Entry: 1i7p (more details), 2 Å

PDB Description: crystal structure of rat b5r in complex with fad
PDB Compounds: (A:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d1i7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7pa1 b.43.4.2 (A:33-153) cytochrome b5 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
itlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnlvirp
ytpvssdddkgfvdlvvkvyfkethpkfpaggkmsqylenmnigdtiefrgpngllvyqg
k

SCOPe Domain Coordinates for d1i7pa1:

Click to download the PDB-style file with coordinates for d1i7pa1.
(The format of our PDB-style files is described here.)

Timeline for d1i7pa1: