SCOPe 2.07: Domain d1i6qa2: 1i6q A:334-689

Lineage for d1i6qa2 (1i6q A:334-689)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [64195] (2 PDB entries)

8. Domain d1i6qa2: 1i6q A:334-689 [66044]
   complexed with co3, fe

Details for d1i6qa2

PDB Entry: 1i6q, 2.7 Å

PDB Description: Formation of a protein intermediate and its trapping by the simultaneous crystallization process: Crystal structure of an iron-saturated intermediate in the FE3+ binding pathway of camel lactoferrin at 2.7 resolution

PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1i6qa2:

Sequence; same for both SEQRES and ATOM records:

>d1i6qa2 c.94.1.2 (A:334-689) Lactoferrin {Camel (Camelus dromedarius) [TaxId: 9838]}
taaevelrraqvvwcavgsdeqlkcqewsrqsnqsvvcatasttedcialvlkgeadals
ldggyiyiagkcglvpvlaesqqspessgldcvhrpvkgylavavvrkandkitwnslrg
kkschtavdrtagwnipmgplfkdtdscrfdeffsqscapgsdprsklcalcagneegql
kcvpnsserlygytgafrclaenvgdvafvkdvtvldntdgkgteqwakdlklgdfellc
lngtrkpvteaeschlpvapnhavvsridkvahlrqvllrqqahfgrngedcpgkfclfq
sktknllfndnteclaklqgkttydeylgpqyvtaiaklrrcstsplleacaflmr

Timeline for d1i6qa2:

• d1i6qa2 first appeared in SCOP 1.59
  
• d1i6qa2 appears in SCOPe 2.06
  
• d1i6qa2 appears in the current release, SCOPe 2.08