Lineage for d1i6ma_ (1i6m A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579981Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 579982Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 579983Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 580060Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species)
    overall structure is similar to TyrRS
  7. 580061Species Bacillus stearothermophilus [TaxId:1422] [52379] (8 PDB entries)
  8. 580063Domain d1i6ma_: 1i6m A: [66042]
    complexed with gol, nh4, so4, tym

Details for d1i6ma_

PDB Entry: 1i6m (more details), 1.72 Å

PDB Description: 1.7 high resolution experimental phases for tryptophanyl-trna synthetase complexed with tryptophanyl-5'amp

SCOP Domain Sequences for d1i6ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6ma_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

SCOP Domain Coordinates for d1i6ma_:

Click to download the PDB-style file with coordinates for d1i6ma_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ma_: