![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
![]() | Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species) overall structure is similar to TyrRS |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [52379] (8 PDB entries) |
![]() | Domain d1i6ma_: 1i6m A: [66042] |
PDB Entry: 1i6m (more details), 1.72 Å
SCOP Domain Sequences for d1i6ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6ma_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus} mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl degaekanrvasemvrkmeqamglgr
Timeline for d1i6ma_: