Lineage for d1i6ka_ (1i6k A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860140Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 2860141Species Bacillus stearothermophilus [TaxId:1422] [52379] (13 PDB entries)
  8. 2860143Domain d1i6ka_: 1i6k A: [66040]
    protein/RNA complex; complexed with gol, nh4, so4, tym

Details for d1i6ka_

PDB Entry: 1i6k (more details), 1.72 Å

PDB Description: 1.7 high resolution experimental phases for tryptophanyl-trna synthetase complexed with tryptophanyl-5'amp
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d1i6ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6ka_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

SCOPe Domain Coordinates for d1i6ka_:

Click to download the PDB-style file with coordinates for d1i6ka_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ka_: