SCOPe 2.01: Domain d1i5fb_: 1i5f B:

Lineage for d1i5fb_ (1i5f B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Major cold shock protein [50283] (4 species)

7. Species Bacillus caldolyticus [TaxId:1394] [50286] (7 PDB entries)

8. Domain d1i5fb_: 1i5f B: [66035]
   complexed with na; mutant

Details for d1i5fb_

PDB Entry: 1i5f, 1.4 Å

PDB Description: bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability

PDB Compounds: (B:) cold-shock protein cspb

SCOPe Domain Sequences for d1i5fb_:

Sequence; same for both SEQRES and ATOM records:

>d1i5fb_ b.40.4.5 (B:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqegkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvkl

Timeline for d1i5fb_:

• d1i5fb_ first appeared in SCOP 1.59
  
• d1i5fb_ appears in SCOP 1.75
  
• d1i5fb_ appears in SCOPe 2.02
  
• d1i5fb_ appears in the current release, SCOPe 2.08