Lineage for d1i56a_ (1i56 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 252026Protein Lysozyme [53961] (16 species)
    ubiquitous in a variety of tussues ans secretions
  7. 252209Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (3 PDB entries)
  8. 252213Domain d1i56a_: 1i56 A: [66033]
    holo-form
    mutant

Details for d1i56a_

PDB Entry: 1i56 (more details)

PDB Description: solution structure of ca2+-bound state of canine milk lysozyme
PDB Compounds: (A:)

SCOP Domain Sequences for d1i56a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i56a_ d.2.1.2 (A:) Lysozyme {Dog (Canis familiaris), milk}
skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
lskylascnl

SCOP Domain Coordinates for d1i56a_:

Click to download the PDB-style file with coordinates for d1i56a_.
(The format of our PDB-style files is described here.)

Timeline for d1i56a_: