SCOP 1.75: Domain d1i51.2: 1i51 C:,D:

Lineage for d1i51.2 (1i51 C:,D:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (2 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins)

6. Protein Caspase-7 [63961] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63962] (9 PDB entries)
   Uniprot P55210 57-303

8. Domain d1i51.2: 1i51 C:,D: [66030]
   complexed to the xiap-bir2 fragment (chains E and F)
   mutant

Details for d1i51.2

PDB Entry: 1i51, 2.45 Å

PDB Description: crystal structure of caspase-7 complexed with xiap

PDB Compounds: (C:) caspase-7 subunit p20, (D:) caspase-7 subunit p11

SCOP Domain Sequences for d1i51.2:

Sequence; same for both SEQRES and ATOM records:

>g1i51.2 c.17.1.1 (C:,D:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]}
yqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsca
kmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktllek
pklffiqacrgtelddgiqXkipveadflfaystvpgyyswrspgrgswfvqalcsilee
hgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfsq

Timeline for d1i51.2:

• d1i51.2 first appeared in SCOP 1.59
  
• d1i51.2 appears in SCOP 1.73
  
• d1i51.2 appears in SCOPe 2.01
  
• d1i51.2 appears in the current release, SCOPe 2.08