Lineage for d1i51.2 (1i51 C:,D:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825082Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 825083Superfamily c.17.1: Caspase-like [52129] (2 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 825084Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins)
  6. 825134Protein Caspase-7 [63961] (1 species)
  7. 825135Species Human (Homo sapiens) [TaxId:9606] [63962] (9 PDB entries)
    Uniprot P55210 57-303
  8. 825141Domain d1i51.2: 1i51 C:,D: [66030]
    complexed to the xiap-bir2 fragment (chains E and F)
    mutant

Details for d1i51.2

PDB Entry: 1i51 (more details), 2.45 Å

PDB Description: crystal structure of caspase-7 complexed with xiap
PDB Compounds: (C:) caspase-7 subunit p20, (D:) caspase-7 subunit p11

SCOP Domain Sequences for d1i51.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1i51.2 c.17.1.1 (C:,D:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]}
yqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsca
kmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgarcktllek
pklffiqacrgtelddgiqXkipveadflfaystvpgyyswrspgrgswfvqalcsilee
hgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmltkelyfsq

SCOP Domain Coordinates for d1i51.2:

Click to download the PDB-style file with coordinates for d1i51.2.
(The format of our PDB-style files is described here.)

Timeline for d1i51.2: