SCOPe 2.07: Domain d1i4sb_: 1i4s B:

Lineage for d1i4sb_ (1i4s B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (3 families)

5. Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
   Pfam PF00636

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)

8. Domain d1i4sb_: 1i4s B: [66027]

Details for d1i4sb_

PDB Entry: 1i4s, 2.15 Å

PDB Description: crystal structure of rnase iii endonuclease domain from aquifex aeolicus at 2.15 angstrom resolution

PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1i4sb_:

Sequence; same for both SEQRES and ATOM records:

>d1i4sb_ a.149.1.1 (B:) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
grdanftrelfyklfkedilsaikegr

Timeline for d1i4sb_:

• d1i4sb_ first appeared in SCOP 1.59
  
• d1i4sb_ appears in SCOPe 2.06
  
• d1i4sb_ appears in the current release, SCOPe 2.08