Lineage for d1i4sa_ (1i4s A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650106Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 650107Superfamily a.149.1: RNase III domain-like [69065] (2 families) (S)
  5. 650108Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 650112Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 650113Species Aquifex aeolicus [TaxId:63363] [69068] (9 PDB entries)
  8. 650123Domain d1i4sa_: 1i4s A: [66026]

Details for d1i4sa_

PDB Entry: 1i4s (more details), 2.15 Å

PDB Description: crystal structure of rnase iii endonuclease domain from aquifex aeolicus at 2.15 angstrom resolution
PDB Compounds: (A:) Ribonuclease III

SCOP Domain Sequences for d1i4sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4sa_ a.149.1.1 (A:) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
grdanftrelfyklfkedilsaikegr

SCOP Domain Coordinates for d1i4sa_:

Click to download the PDB-style file with coordinates for d1i4sa_.
(The format of our PDB-style files is described here.)

Timeline for d1i4sa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i4sb_