SCOP 1.63: Domain d1i4sa_: 1i4s A:

Lineage for d1i4sa_ (1i4s A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.149: RNase III endonuclease catalytic domain [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III endonuclease catalytic domain [69065] (1 family)

5. Family a.149.1.1: RNase III endonuclease catalytic domain [69066] (1 protein)

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (2 PDB entries)

8. Domain d1i4sa_: 1i4s A: [66026]

Details for d1i4sa_

PDB Entry: 1i4s, 2.15 Å

PDB Description: crystal structure of rnase iii endonuclease domain from aquifex aeolicus at 2.15 angstrom resolution

SCOP Domain Sequences for d1i4sa_:

Sequence; same for both SEQRES and ATOM records:

>d1i4sa_ a.149.1.1 (A:) RNase III endonuclease catalytic domain {Aquifex aeolicus}
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
grdanftrelfyklfkedilsaikegr

Timeline for d1i4sa_:

• d1i4sa_ first appeared in SCOP 1.59
  
• d1i4sa_ appears in SCOP 1.61
  
• d1i4sa_ appears in SCOP 1.65
  
• d1i4sa_ appears in the current release, SCOPe 2.08