Class a: All alpha proteins [46456] (290 folds) |
Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.149.1: RNase III domain-like [69065] (3 families) |
Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins) Pfam PF00636 |
Protein RNase III endonuclease catalytic domain [69067] (2 species) |
Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries) |
Domain d1i4sa_: 1i4s A: [66026] |
PDB Entry: 1i4s (more details), 2.15 Å
SCOPe Domain Sequences for d1i4sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4sa_ a.149.1.1 (A:) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]} mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids grdanftrelfyklfkedilsaikegr
Timeline for d1i4sa_: