Lineage for d1i3pa_ (1i3p A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042181Fold b.28: Baculovirus p35 protein [49893] (1 superfamily)
    sandwich; 14 strands in 2 sheets; greek-key
  4. 2042182Superfamily b.28.1: Baculovirus p35 protein [49894] (1 family) (S)
    has a few helices inserted in loops
    automatically mapped to Pfam PF02331
  5. 2042183Family b.28.1.1: Baculovirus p35 protein [49895] (1 protein)
  6. 2042184Protein Baculovirus p35 protein [49896] (1 species)
    Apoptotic caspase inhibitor
  7. 2042185Species AcMNPV (Autographa californica nuclear polyhedrosis virus) [TaxId:46015] [49897] (5 PDB entries)
  8. 2042195Domain d1i3pa_: 1i3p A: [66020]
    after caspase cleavage

Details for d1i3pa_

PDB Entry: 1i3p (more details), 3.1 Å

PDB Description: the 3.1 angstrom resolution crystal structure of a mutated baculovirus p35 after caspase cleavage
PDB Compounds: (A:) Early 35 kDa protein

SCOPe Domain Sequences for d1i3pa_:

Sequence, based on SEQRES records: (download)

>d1i3pa_ b.28.1.1 (A:) Baculovirus p35 protein {AcMNPV (Autographa californica nuclear polyhedrosis virus) [TaxId: 46015]}
pveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknnnlrd
rikskpdeqfdqlekdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilkshdyt
dkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivpfahe
indtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksmiyka
lefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilnti

Sequence, based on observed residues (ATOM records): (download)

>d1i3pa_ b.28.1.1 (A:) Baculovirus p35 protein {AcMNPV (Autographa californica nuclear polyhedrosis virus) [TaxId: 46015]}
pveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknnnlrd
rikskpdeqfdqlekdydsikyfkdehysvscqngsvlkskfakilkshdytdkksieay
ekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivpfaheindtglye
ydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneaksmiykalefttkynwki
fcngfiydkkskvlyvklhnvtsalnknvilnti

SCOPe Domain Coordinates for d1i3pa_:

Click to download the PDB-style file with coordinates for d1i3pa_.
(The format of our PDB-style files is described here.)

Timeline for d1i3pa_: