SCOP 1.65: Domain d1i3gh_: 1i3g H:

Lineage for d1i3gh_ (1i3g H:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1i3gh_: 1i3g H: [66018]
   Other proteins in same PDB: d1i3gl_
   part of anti-ampicillin scFv
   complexed with mpd

Details for d1i3gh_

PDB Entry: 1i3g, 2.44 Å

PDB Description: crystal structure of an ampicillin single chain fv, form 1, free

SCOP Domain Sequences for d1i3gh_:

Sequence; same for both SEQRES and ATOM records:

>d1i3gh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqpgaelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytny
nqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvs

Timeline for d1i3gh_:

• d1i3gh_ first appeared in SCOP 1.59
  
• d1i3gh_ appears in SCOP 1.63
  
• d1i3gh_ appears in SCOP 1.67
  
• d1i3gh_ appears in the current release, SCOPe 2.08, called d1i3gh1