Lineage for d1i3gh1 (1i3g H:6-148)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2344816Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2345323Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2345387Domain d1i3gh1: 1i3g H:6-148 [66018]
    Other proteins in same PDB: d1i3gh2, d1i3gl_
    part of anti-ampicillin scFv
    complexed with mpd

Details for d1i3gh1

PDB Entry: 1i3g (more details), 2.44 Å

PDB Description: crystal structure of an ampicillin single chain fv, form 1, free
PDB Compounds: (H:) antibody fv fragment

SCOPe Domain Sequences for d1i3gh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3gh1 b.1.1.1 (H:6-148) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qpgaelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytnynqkfk
dkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvs

SCOPe Domain Coordinates for d1i3gh1:

Click to download the PDB-style file with coordinates for d1i3gh1.
(The format of our PDB-style files is described here.)

Timeline for d1i3gh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i3gh2
View in 3D
Domains from other chains:
(mouse over for more information)
d1i3gl_