Lineage for d1i35a_ (1i35 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 130888Superfamily d.15.1: Ubiquitin-like [54236] (5 families) (S)
  5. 130966Family d.15.1.5: Ras-binding domain, RBD [54263] (6 proteins)
  6. 130985Protein Protein kinase byr2 [69662] (1 species)
  7. 130986Species Yest (Schizosaccharomyces pombe) [69663] (1 PDB entry)
  8. 130987Domain d1i35a_: 1i35 A: [66017]

Details for d1i35a_

PDB Entry: 1i35 (more details)

PDB Description: solution structure of the ras-binding domain of the protein kinase byr2 from schizosaccharomyces pombe

SCOP Domain Sequences for d1i35a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i35a_ d.15.1.5 (A:) Protein kinase byr2 {Yest (Schizosaccharomyces pombe)}
cilrfiacngqtravqsrgdyqktlaialkkfsledaskfivcvsqssrikliteeefkq
icfnsssperdrliivpkekpcpsfedlrrsweie

SCOP Domain Coordinates for d1i35a_:

Click to download the PDB-style file with coordinates for d1i35a_.
(The format of our PDB-style files is described here.)

Timeline for d1i35a_: