SCOP 1.71: Domain d1i33f1: 1i33 F:1-165,F:335-358

Lineage for d1i33f1 (1i33 F:1-165,F:335-358)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)

7. Species Leishmania mexicana [TaxId:5665] [51809] (5 PDB entries)

8. Domain d1i33f1: 1i33 F:1-165,F:335-358 [66015]
   Other proteins in same PDB: d1i33a2, d1i33b2, d1i33c2, d1i33d2, d1i33e2, d1i33f2
   complexed with tnd

Details for d1i33f1

PDB Entry: 1i33, 3 Å

PDB Description: leishmania mexicana glyceraldehyde-3-phosphate dehydrogenase in complex with inhibitors

SCOP Domain Sequences for d1i33f1:

Sequence; same for both SEQRES and ATOM records:

>d1i33f1 c.2.1.3 (F:1-165,F:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

Timeline for d1i33f1:

• d1i33f1 first appeared in SCOP 1.59
  
• d1i33f1 appears in SCOP 1.69
  
• d1i33f1 appears in SCOP 1.73
  
• d1i33f1 appears in the current release, SCOPe 2.08