| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species) |
| Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51809] (5 PDB entries) |
| Domain d1i33e1: 1i33 E:1-165,E:335-358 [66013] Other proteins in same PDB: d1i33a2, d1i33b2, d1i33c2, d1i33d2, d1i33e2, d1i33f2 complexed with tnd |
PDB Entry: 1i33 (more details), 3 Å
SCOPe Domain Sequences for d1i33e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i33e1 c.2.1.3 (E:1-165,E:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass
Timeline for d1i33e1: