Lineage for d1i33b1 (1i33 B:1-165,B:335-358)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118495Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (12 species)
  7. 118545Species Leishmania mexicana [TaxId:5665] [51809] (5 PDB entries)
  8. 118561Domain d1i33b1: 1i33 B:1-165,B:335-358 [66007]
    Other proteins in same PDB: d1i33a2, d1i33b2, d1i33c2, d1i33d2, d1i33e2, d1i33f2

Details for d1i33b1

PDB Entry: 1i33 (more details), 3 Å

PDB Description: leishmania mexicana glyceraldehyde-3-phosphate dehydrogenase in complex with inhibitors

SCOP Domain Sequences for d1i33b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i33b1 c.2.1.3 (B:1-165,B:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOP Domain Coordinates for d1i33b1:

Click to download the PDB-style file with coordinates for d1i33b1.
(The format of our PDB-style files is described here.)

Timeline for d1i33b1: