SCOP 1.75: Domain d1i32f2: 1i32 F:166-334

Lineage for d1i32f2 (1i32 F:166-334)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Leishmania mexicana [TaxId:5665] [55357] (5 PDB entries)

8. Domain d1i32f2: 1i32 F:166-334 [66004]
   Other proteins in same PDB: d1i32a1, d1i32b1, d1i32c1, d1i32d1, d1i32e1, d1i32f1
   complexed with nmd

Details for d1i32f2

PDB Entry: 1i32, 2.6 Å

PDB Description: leishmania mexicana glyceraldehyde-3-phosphate dehydrogenase in complex with inhibitors

PDB Compounds: (F:) glyceraldehyde 3-phosphate dehydrogenase

SCOP Domain Sequences for d1i32f2:

Sequence; same for both SEQRES and ATOM records:

>d1i32f2 d.81.1.1 (F:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana [TaxId: 5665]}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

Timeline for d1i32f2:

• d1i32f2 first appeared in SCOP 1.59
  
• d1i32f2 appears in SCOP 1.73
  
• d1i32f2 appears in SCOPe 2.01
  
• d1i32f2 appears in the current release, SCOPe 2.08