Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51809] (5 PDB entries) |
Domain d1i32d1: 1i32 D:1-165,D:335-358 [65999] Other proteins in same PDB: d1i32a2, d1i32b2, d1i32c2, d1i32d2, d1i32e2, d1i32f2 complexed with nmd |
PDB Entry: 1i32 (more details), 2.6 Å
SCOPe Domain Sequences for d1i32d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i32d1 c.2.1.3 (D:1-165,D:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]} apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr ymaakdaass
Timeline for d1i32d1: