Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins) |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (12 species) |
Species Leishmania mexicana [TaxId:5665] [51809] (5 PDB entries) |
Domain d1i32d1: 1i32 D:1-165,D:335-358 [65999] Other proteins in same PDB: d1i32a2, d1i32b2, d1i32c2, d1i32d2, d1i32e2, d1i32f2 |
PDB Entry: 1i32 (more details), 2.6 Å
SCOP Domain Sequences for d1i32d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i32d1 c.2.1.3 (D:1-165,D:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana} apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr ymaakdaass
Timeline for d1i32d1: