Lineage for d1i32c1 (1i32 C:1-165,C:335-358)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175469Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
  6. 175557Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
  7. 175607Species Leishmania mexicana [TaxId:5665] [51809] (5 PDB entries)
  8. 175610Domain d1i32c1: 1i32 C:1-165,C:335-358 [65997]
    Other proteins in same PDB: d1i32a2, d1i32b2, d1i32c2, d1i32d2, d1i32e2, d1i32f2

Details for d1i32c1

PDB Entry: 1i32 (more details), 2.6 Å

PDB Description: leishmania mexicana glyceraldehyde-3-phosphate dehydrogenase in complex with inhibitors

SCOP Domain Sequences for d1i32c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i32c1 c.2.1.3 (C:1-165,C:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOP Domain Coordinates for d1i32c1:

Click to download the PDB-style file with coordinates for d1i32c1.
(The format of our PDB-style files is described here.)

Timeline for d1i32c1: