Lineage for d1i32b1 (1i32 B:1-165,B:335-358)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1829082Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51809] (5 PDB entries)
  8. 1829084Domain d1i32b1: 1i32 B:1-165,B:335-358 [65995]
    Other proteins in same PDB: d1i32a2, d1i32b2, d1i32c2, d1i32d2, d1i32e2, d1i32f2
    complexed with nmd

Details for d1i32b1

PDB Entry: 1i32 (more details), 2.6 Å

PDB Description: leishmania mexicana glyceraldehyde-3-phosphate dehydrogenase in complex with inhibitors
PDB Compounds: (B:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1i32b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i32b1 c.2.1.3 (B:1-165,B:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOPe Domain Coordinates for d1i32b1:

Click to download the PDB-style file with coordinates for d1i32b1.
(The format of our PDB-style files is described here.)

Timeline for d1i32b1: