Lineage for d1i2va_ (1i2v A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521435Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 521618Family g.3.7.4: Insect defensins [57163] (5 proteins)
  6. 521635Protein Heliomicin [69935] (1 species)
  7. 521636Species Tobacco budworm (Heliothis virescens) [TaxId:7102] [69936] (2 PDB entries)
  8. 521638Domain d1i2va_: 1i2v A: [65988]
    an antifungal and antibacterial mutant

Details for d1i2va_

PDB Entry: 1i2v (more details)

PDB Description: nmr solution structures of an antifungal and antibacterial mutant of heliomicin

SCOP Domain Sequences for d1i2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2va_ g.3.7.4 (A:) Heliomicin {Tobacco budworm (Heliothis virescens)}
dkligscvwgavnytsdcngecllrgykgghcgsfanvncwcet

SCOP Domain Coordinates for d1i2va_:

Click to download the PDB-style file with coordinates for d1i2va_.
(The format of our PDB-style files is described here.)

Timeline for d1i2va_: