Lineage for d1i2ua_ (1i2u A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 341858Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 341999Family g.3.7.4: Insect defensins [57163] (4 proteins)
  6. 342011Protein Heliomicin [69935] (1 species)
  7. 342012Species Tobacco budworm (Heliothis virescens) [TaxId:7102] [69936] (2 PDB entries)
  8. 342013Domain d1i2ua_: 1i2u A: [65987]
    antifungal protein

Details for d1i2ua_

PDB Entry: 1i2u (more details)

PDB Description: nmr solution structures of antifungal heliomicin

SCOP Domain Sequences for d1i2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2ua_ g.3.7.4 (A:) Heliomicin {Tobacco budworm (Heliothis virescens)}
dkligscvwgavnytsdcngeckrrgykgghcgsfanvncwcet

SCOP Domain Coordinates for d1i2ua_:

Click to download the PDB-style file with coordinates for d1i2ua_.
(The format of our PDB-style files is described here.)

Timeline for d1i2ua_: