Lineage for d1i26a_ (1i26 A:)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.6: omega toxin-like [57059] (3 families) 
Family g.3.6.3: Insect toxins [69930] (1 protein) Protein PTU-1 [69931] (1 species) Species Assassin bug (Peirates turpis) [TaxId:181095] [69932] (1 PDB entry) 
Domain d1i26a_: 1i26 A: [65986]
Details for d1i26a_
PDB Entry: 1i26 (more details)
PDB Description: solution structure of ptu-1, a toxin from the assassin bugs peirates turpis that blocks the voltage sensitive calcium channel n-type
SCOP Domain Sequences for d1i26a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i26a_ g.3.6.3 (A:) PTU-1 {Assassin bug (Peirates turpis)}
aekdciapgapcfgtdkpccnprawcssyankcl
SCOP Domain Coordinates for d1i26a_:
Click to download the PDB-style file with coordinates for d1i26a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i26a_:
- d1i26a_ is new in SCOP 1.59
- d1i26a_ appears in SCOP 1.61
- d1i26a_ appears in the current release, SCOPe 2.08
View in 3D