Lineage for d1i26a_ (1i26 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030282Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 3030437Family g.3.6.3: Insect toxins [69930] (2 proteins)
  6. 3030441Protein PTU-1 [69931] (1 species)
  7. 3030442Species Assassin bug (Peirates turpis) [TaxId:181095] [69932] (1 PDB entry)
  8. 3030443Domain d1i26a_: 1i26 A: [65986]

Details for d1i26a_

PDB Entry: 1i26 (more details)

PDB Description: solution structure of ptu-1, a toxin from the assassin bugs peirates turpis that blocks the voltage sensitive calcium channel n-type
PDB Compounds: (A:) ptu-1

SCOPe Domain Sequences for d1i26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i26a_ g.3.6.3 (A:) PTU-1 {Assassin bug (Peirates turpis) [TaxId: 181095]}
aekdciapgapcfgtdkpccnprawcssyankcl

SCOPe Domain Coordinates for d1i26a_:

Click to download the PDB-style file with coordinates for d1i26a_.
(The format of our PDB-style files is described here.)

Timeline for d1i26a_: