Lineage for d1i1gb2 (1i1g B:62-141)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 134315Superfamily d.58.37: Lrp/AsnC-like transcriptional regulator C-terminal domain [69732] (1 family) (S)
  5. 134316Family d.58.37.1: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (1 protein)
  6. 134317Protein LprA [69734] (1 species)
  7. 134318Species Archaeon Pyrococcus furiosus [TaxId:2261] [69735] (1 PDB entry)
  8. 134320Domain d1i1gb2: 1i1g B:62-141 [65985]
    Other proteins in same PDB: d1i1ga1, d1i1gb1

Details for d1i1gb2

PDB Entry: 1i1g (more details), 2.9 Å

PDB Description: crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus

SCOP Domain Sequences for d1i1gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1gb2 d.58.37.1 (B:62-141) LprA {Archaeon Pyrococcus furiosus}
yslvtitgvdtkpeklfevaeklkeydfvkelylssgdhmimaviwakdgedlaeiisnk
igkiegvtkvcpaiileklk

SCOP Domain Coordinates for d1i1gb2:

Click to download the PDB-style file with coordinates for d1i1gb2.
(The format of our PDB-style files is described here.)

Timeline for d1i1gb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i1gb1