Lineage for d1i1ga2 (1i1g A:62-141)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 193056Superfamily d.58.37: Lrp/AsnC-like transcriptional regulator C-terminal domain [69732] (1 family) (S)
  5. 193057Family d.58.37.1: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (1 protein)
  6. 193058Protein LprA [69734] (1 species)
  7. 193059Species Archaeon Pyrococcus furiosus [TaxId:2261] [69735] (1 PDB entry)
  8. 193060Domain d1i1ga2: 1i1g A:62-141 [65983]
    Other proteins in same PDB: d1i1ga1, d1i1gb1

Details for d1i1ga2

PDB Entry: 1i1g (more details), 2.9 Å

PDB Description: crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus

SCOP Domain Sequences for d1i1ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ga2 d.58.37.1 (A:62-141) LprA {Archaeon Pyrococcus furiosus}
yslvtitgvdtkpeklfevaeklkeydfvkelylssgdhmimaviwakdgedlaeiisnk
igkiegvtkvcpaiileklk

SCOP Domain Coordinates for d1i1ga2:

Click to download the PDB-style file with coordinates for d1i1ga2.
(The format of our PDB-style files is described here.)

Timeline for d1i1ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i1ga1