Lineage for d1i1ea3 (1i1e A:1-533)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135769Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 135770Protein Botulinum neurotoxin [55513] (2 species)
  7. 135773Species Clostridium botulinum, serotype B [TaxId:1491] [55515] (6 PDB entries)
  8. 135777Domain d1i1ea3: 1i1e A:1-533 [65980]
    Other proteins in same PDB: d1i1ea1, d1i1ea2, d1i1ea4

Details for d1i1ea3

PDB Entry: 1i1e (more details), 2.5 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with doxorubicin

SCOP Domain Sequences for d1i1ea3:

Sequence, based on SEQRES records: (download)

>d1i1ea3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

Sequence, based on observed residues (ATOM records): (download)

>d1i1ea3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvgicidvdnedlffiadknsfsddlsknerieyntqsnyien
dfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

SCOP Domain Coordinates for d1i1ea3:

Click to download the PDB-style file with coordinates for d1i1ea3.
(The format of our PDB-style files is described here.)

Timeline for d1i1ea3: