Lineage for d1i1ea3 (1i1e A:1-533)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964005Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2964006Protein Botulinum neurotoxin [55513] (4 species)
  7. 2964045Species Clostridium botulinum, serotype B [TaxId:1491] [55515] (17 PDB entries)
  8. 2964055Domain d1i1ea3: 1i1e A:1-533 [65980]
    Other proteins in same PDB: d1i1ea1, d1i1ea2, d1i1ea4
    complexed with dm2, so4, zn

Details for d1i1ea3

PDB Entry: 1i1e (more details), 2.5 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with doxorubicin
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1i1ea3:

Sequence, based on SEQRES records: (download)

>d1i1ea3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

Sequence, based on observed residues (ATOM records): (download)

>d1i1ea3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvgicidvdnedlffiadknsfsddlsknerieyntqsnyien
dfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

SCOPe Domain Coordinates for d1i1ea3:

Click to download the PDB-style file with coordinates for d1i1ea3.
(The format of our PDB-style files is described here.)

Timeline for d1i1ea3: