Lineage for d1i1ea1 (1i1e A:862-1079)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043490Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 protein domains)
    automatically mapped to Pfam PF07953
  6. 2043491Protein Botulinum neurotoxin [49959] (2 species)
  7. 2043500Species Clostridium botulinum, serotype B [TaxId:1491] [49961] (14 PDB entries)
  8. 2043510Domain d1i1ea1: 1i1e A:862-1079 [65978]
    Other proteins in same PDB: d1i1ea2, d1i1ea3, d1i1ea4
    complexed with dm2, so4, zn

Details for d1i1ea1

PDB Entry: 1i1e (more details), 2.5 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with doxorubicin
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1i1ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ea1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntelsqsnieerykiqsy

SCOPe Domain Coordinates for d1i1ea1:

Click to download the PDB-style file with coordinates for d1i1ea1.
(The format of our PDB-style files is described here.)

Timeline for d1i1ea1: