Lineage for d1i09a_ (1i09 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 612217Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 612218Species Human (Homo sapiens) [TaxId:9606] [69824] (14 PDB entries)
  8. 612243Domain d1i09a_: 1i09 A: [65976]

Details for d1i09a_

PDB Entry: 1i09 (more details), 2.7 Å

PDB Description: structure of glycogen synthase kinase-3 (gsk3b)

SCOP Domain Sequences for d1i09a_:

Sequence, based on SEQRES records: (download)

>d1i09a_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
smkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvai
kkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvar
hysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsa
kqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvd
qlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleyt
ptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

Sequence, based on observed residues (ATOM records): (download)

>d1i09a_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
smkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvai
kkvlqdkrfknrelqimrkldhcnivrlryffyssylnlvldyvpetvyrvarhysrakq
tlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrge
pnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiik
vlgtptreqiremnwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdp
nvklpngrdtpalfnfttqelssnpplatilipphari

SCOP Domain Coordinates for d1i09a_:

Click to download the PDB-style file with coordinates for d1i09a_.
(The format of our PDB-style files is described here.)

Timeline for d1i09a_: