SCOPe 2.08: Domain d1hzma_: 1hzm A:

Lineage for d1hzma_ (1hzm A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins)

6. Protein Erk2 binding domain of Mapk phosphatase mkp-3 [69507] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69508] (1 PDB entry)

8. Domain d1hzma_: 1hzm A: [65975]

Details for d1hzma_

PDB Entry: 1hzm

PDB Description: structure of erk2 binding domain of mapk phosphatase mkp-3: structural insights into mkp-3 activation by erk2

PDB Compounds: (A:) Dual specificity protein phosphatase 6

SCOPe Domain Sequences for d1hzma_:

Sequence; same for both SEQRES and ATOM records:

>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]}
midtlrpvpfasemaisktvawlneqlelgnerlllmdcrpqelyesshiesainvaipg
imlrrlqkgnlpvralftrgedrdrftrrcgtdtvvlydesssdwnentggesllglllk
klkdegcrafyleggfskfqaefslhcetnldgs

Timeline for d1hzma_:

• d1hzma_ first appeared in SCOP 1.59
  
• d1hzma_ appears in SCOPe 2.07