SCOP 1.75: Domain d1hzdf_: 1hzd F:

Lineage for d1hzdf_ (1hzd F:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.3: Crotonase-like [52103] (13 proteins)

6. Protein AUH protein [69440] (1 species)
   an RNA-binding homologue of enoyl-CoA hydratase

7. Species Human (Homo sapiens) [TaxId:9606] [69441] (1 PDB entry)

8. Domain d1hzdf_: 1hzd F: [65974]

Details for d1hzdf_

PDB Entry: 1hzd, 2.2 Å

PDB Description: crystal structure of human auh protein, an rna-binding homologue of enoyl-coa hydratase

PDB Compounds: (F:) au-binding protein/enoyl-coa hydratase

SCOP Domain Sequences for d1hzdf_:

Sequence; same for both SEQRES and ATOM records:

>d1hzdf_ c.14.1.3 (F:) AUH protein {Human (Homo sapiens) [TaxId: 9606]}
delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
tiptkdrlegllafkekrpprykge

Timeline for d1hzdf_:

• d1hzdf_ first appeared in SCOP 1.59
  
• d1hzdf_ appears in SCOP 1.73
  
• d1hzdf_ appears in SCOPe 2.01
  
• d1hzdf_ appears in the current release, SCOPe 2.08