Lineage for d1hzde_ (1hzd E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1835691Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 1835720Protein AUH protein [69440] (1 species)
    an RNA-binding homologue of enoyl-CoA hydratase
  7. 1835721Species Human (Homo sapiens) [TaxId:9606] [69441] (3 PDB entries)
  8. 1835732Domain d1hzde_: 1hzd E: [65973]

Details for d1hzde_

PDB Entry: 1hzd (more details), 2.2 Å

PDB Description: crystal structure of human auh protein, an rna-binding homologue of enoyl-coa hydratase
PDB Compounds: (E:) au-binding protein/enoyl-coa hydratase

SCOPe Domain Sequences for d1hzde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzde_ c.14.1.3 (E:) AUH protein {Human (Homo sapiens) [TaxId: 9606]}
edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
qtiptkdrlegllafkekrpprykge

SCOPe Domain Coordinates for d1hzde_:

Click to download the PDB-style file with coordinates for d1hzde_.
(The format of our PDB-style files is described here.)

Timeline for d1hzde_: