Lineage for d1hzdd_ (1hzd D:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690760Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 690789Protein AUH protein [69440] (1 species)
    an RNA-binding homologue of enoyl-CoA hydratase
  7. 690790Species Human (Homo sapiens) [TaxId:9606] [69441] (1 PDB entry)
  8. 690794Domain d1hzdd_: 1hzd D: [65972]

Details for d1hzdd_

PDB Entry: 1hzd (more details), 2.2 Å

PDB Description: crystal structure of human auh protein, an rna-binding homologue of enoyl-coa hydratase
PDB Compounds: (D:) au-binding protein/enoyl-coa hydratase

SCOP Domain Sequences for d1hzdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzdd_ c.14.1.3 (D:) AUH protein {Human (Homo sapiens) [TaxId: 9606]}
delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
tiptkdrlegllafkekrpprykge

SCOP Domain Coordinates for d1hzdd_:

Click to download the PDB-style file with coordinates for d1hzdd_.
(The format of our PDB-style files is described here.)

Timeline for d1hzdd_: