Lineage for d1hzdc_ (1hzd C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824388Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 824389Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 824543Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 824572Protein AUH protein [69440] (1 species)
    an RNA-binding homologue of enoyl-CoA hydratase
  7. 824573Species Human (Homo sapiens) [TaxId:9606] [69441] (1 PDB entry)
  8. 824576Domain d1hzdc_: 1hzd C: [65971]

Details for d1hzdc_

PDB Entry: 1hzd (more details), 2.2 Å

PDB Description: crystal structure of human auh protein, an rna-binding homologue of enoyl-coa hydratase
PDB Compounds: (C:) au-binding protein/enoyl-coa hydratase

SCOP Domain Sequences for d1hzdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzdc_ c.14.1.3 (C:) AUH protein {Human (Homo sapiens) [TaxId: 9606]}
edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
qtiptkdrlegllafkekrpprykge

SCOP Domain Coordinates for d1hzdc_:

Click to download the PDB-style file with coordinates for d1hzdc_.
(The format of our PDB-style files is described here.)

Timeline for d1hzdc_: