SCOP 1.73: Domain d1hzdb_: 1hzd B:

Lineage for d1hzdb_ (1hzd B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.3: Crotonase-like [52103] (13 proteins)

6. Protein AUH protein [69440] (1 species)
   an RNA-binding homologue of enoyl-CoA hydratase

7. Species Human (Homo sapiens) [TaxId:9606] [69441] (1 PDB entry)

8. Domain d1hzdb_: 1hzd B: [65970]

Details for d1hzdb_

PDB Entry: 1hzd, 2.2 Å

PDB Description: crystal structure of human auh protein, an rna-binding homologue of enoyl-coa hydratase

PDB Compounds: (B:) au-binding protein/enoyl-coa hydratase

SCOP Domain Sequences for d1hzdb_:

Sequence; same for both SEQRES and ATOM records:

>d1hzdb_ c.14.1.3 (B:) AUH protein {Human (Homo sapiens) [TaxId: 9606]}
delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
tiptkdrlegllafkekrpprykge

Timeline for d1hzdb_:

• d1hzdb_ first appeared in SCOP 1.59
  
• d1hzdb_ appears in SCOP 1.71
  
• d1hzdb_ appears in SCOP 1.75
  
• d1hzdb_ appears in the current release, SCOPe 2.08