Lineage for d1hzda_ (1hzd A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 981011Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 981040Protein AUH protein [69440] (1 species)
    an RNA-binding homologue of enoyl-CoA hydratase
  7. 981041Species Human (Homo sapiens) [TaxId:9606] [69441] (3 PDB entries)
  8. 981048Domain d1hzda_: 1hzd A: [65969]

Details for d1hzda_

PDB Entry: 1hzd (more details), 2.2 Å

PDB Description: crystal structure of human auh protein, an rna-binding homologue of enoyl-coa hydratase
PDB Compounds: (A:) au-binding protein/enoyl-coa hydratase

SCOPe Domain Sequences for d1hzda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]}
edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
qtiptkdrlegllafkekrpprykge

SCOPe Domain Coordinates for d1hzda_:

Click to download the PDB-style file with coordinates for d1hzda_.
(The format of our PDB-style files is described here.)

Timeline for d1hzda_: