Lineage for d1hzcb_ (1hzc B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 protein domains)
    barrel, closed; n=5, S=8
  6. 1789159Protein Major cold shock protein [50283] (4 species)
  7. 1789160Species Bacillus caldolyticus [TaxId:1394] [50286] (7 PDB entries)
  8. 1789168Domain d1hzcb_: 1hzc B: [65968]
    complexed with na; mutant

Details for d1hzcb_

PDB Entry: 1hzc (more details), 1.32 Å

PDB Description: bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
PDB Compounds: (B:) Cold shock protein cspB

SCOPe Domain Sequences for d1hzcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzcb_ b.40.4.5 (B:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqegkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqavsfeivqgnrgpqa
anvvke

SCOPe Domain Coordinates for d1hzcb_:

Click to download the PDB-style file with coordinates for d1hzcb_.
(The format of our PDB-style files is described here.)

Timeline for d1hzcb_: