SCOPe 2.06: Domain d1hzab_: 1hza B:

Lineage for d1hzab_ (1hza B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Major cold shock protein [50283] (4 species)

7. Species Bacillus caldolyticus [TaxId:1394] [50286] (8 PDB entries)

8. Domain d1hzab_: 1hza B: [65964]
   mutant

Details for d1hzab_

PDB Entry: 1hza, 1.8 Å

PDB Description: bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability

PDB Compounds: (B:) Cold shock protein cspB

SCOPe Domain Sequences for d1hzab_:

Sequence; same for both SEQRES and ATOM records:

>d1hzab_ b.40.4.5 (B:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvtkea

Timeline for d1hzab_:

• d1hzab_ first appeared in SCOP 1.59
  
• d1hzab_ appears in SCOPe 2.05
  
• d1hzab_ appears in SCOPe 2.07
  
• d1hzab_ appears in the current release, SCOPe 2.08