SCOP 1.75: Domain d1hz9b_: 1hz9 B:

Lineage for d1hz9b_ (1hz9 B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein Major cold shock protein [50283] (4 species)

7. Species Bacillus caldolyticus [TaxId:1394] [50286] (7 PDB entries)

8. Domain d1hz9b_: 1hz9 B: [65962]
   mutant

Details for d1hz9b_

PDB Entry: 1hz9, 1.8 Å

PDB Description: bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability

PDB Compounds: (B:) Cold shock protein cspB

SCOP Domain Sequences for d1hz9b_:

Sequence; same for both SEQRES and ATOM records:

>d1hz9b_ b.40.4.5 (B:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqavsfeivqgnrgpqa
anvvkl

Timeline for d1hz9b_:

• d1hz9b_ first appeared in SCOP 1.59
  
• d1hz9b_ appears in SCOP 1.73
  
• d1hz9b_ appears in SCOPe 2.01
  
• d1hz9b_ appears in the current release, SCOPe 2.08