Lineage for d1hz9a_ (1hz9 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110553Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) (S)
  5. 110688Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (13 proteins)
  6. 110698Protein Major cold shock protein [50283] (4 species)
  7. 110699Species Bacillus caldolyticus [TaxId:1394] [50286] (6 PDB entries)
  8. 110708Domain d1hz9a_: 1hz9 A: [65961]

Details for d1hz9a_

PDB Entry: 1hz9 (more details), 1.8 Å

PDB Description: bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability

SCOP Domain Sequences for d1hz9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hz9a_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqavsfeivqgnrgpqa
anvvkl

SCOP Domain Coordinates for d1hz9a_:

Click to download the PDB-style file with coordinates for d1hz9a_.
(The format of our PDB-style files is described here.)

Timeline for d1hz9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hz9b_