Lineage for d1hz4a_ (1hz4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010681Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2010839Family a.118.8.2: Transcription factor MalT domain III [69094] (1 protein)
  6. 2010840Protein Transcription factor MalT domain III [69095] (1 species)
  7. 2010841Species Escherichia coli [TaxId:562] [69096] (1 PDB entry)
  8. 2010842Domain d1hz4a_: 1hz4 A: [65960]
    complexed with bez, gol, so4

Details for d1hz4a_

PDB Entry: 1hz4 (more details), 1.45 Å

PDB Description: crystal structure of transcription factor malt domain iii
PDB Compounds: (A:) malt regulatory protein

SCOPe Domain Sequences for d1hz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}
eikdiredtmhaefnalraqvaindgnpdeaerlaklaleelppgwfysrivatsvlgev
lhckgeltrslalmqqteqmarqhdvwhyalwsliqqseilfaqgflqtawetqekafql
ineqhleqlpmheflvriraqllwawarldeaeasarsgievlssyqpqqqlqclamliq
cslargdldnarsqlnrlenllgngkyhsdwisnankvrviywqmtgdkaaaanwlrhta
kpefannhflqgqwrniaraqillgefepaeivleelnenarslrlmsdlnrnllllnql
ywqagrksdaqrvlldalklanrtgfishfviegeamaqqlrqliqlntlpeleqhraqr
ilrein

SCOPe Domain Coordinates for d1hz4a_:

Click to download the PDB-style file with coordinates for d1hz4a_.
(The format of our PDB-style files is described here.)

Timeline for d1hz4a_: