Lineage for d1hz4a_ (1hz4 A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies) Superfamily a.118.8: TPR-like [48452] (2 families) 
Family a.118.8.2: Transcription factor MalT domain III [69094] (1 protein) Protein Transcription factor MalT domain III [69095] (1 species) Species Escherichia coli [TaxId:562] [69096] (1 PDB entry) 
Domain d1hz4a_: 1hz4 A: [65960]
Details for d1hz4a_
PDB Entry: 1hz4 (more details), 1.45 Å
PDB Description: crystal structure of transcription factor malt domain iii
SCOP Domain Sequences for d1hz4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli}
eikdiredtmhaefnalraqvaindgnpdeaerlaklaleelppgwfysrivatsvlgev
lhckgeltrslalmqqteqmarqhdvwhyalwsliqqseilfaqgflqtawetqekafql
ineqhleqlpmheflvriraqllwawarldeaeasarsgievlssyqpqqqlqclamliq
cslargdldnarsqlnrlenllgngkyhsdwisnankvrviywqmtgdkaaaanwlrhta
kpefannhflqgqwrniaraqillgefepaeivleelnenarslrlmsdlnrnllllnql
ywqagrksdaqrvlldalklanrtgfishfviegeamaqqlrqliqlntlpeleqhraqr
ilrein
SCOP Domain Coordinates for d1hz4a_:
Click to download the PDB-style file with coordinates for d1hz4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hz4a_:
- d1hz4a_ is new in SCOP 1.59
- d1hz4a_ appears in SCOP 1.61
- d1hz4a_ appears in the current release, SCOPe 2.08
View in 3D