SCOP 1.63: Domain d1hxs2_: 1hxs 2:

Lineage for d1hxs2_ (1hxs 2:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (18 proteins)
   mammalian viruses

6. Protein Poliovirus [49666] (3 species)

7. Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (11 PDB entries)

8. Domain d1hxs2_: 1hxs 2: [65953]

Details for d1hxs2_

PDB Entry: 1hxs, 2.2 Å

PDB Description: crystal structure of mahoney strain of poliovirus at 2.2a resolution

SCOP Domain Sequences for d1hxs2_:

Sequence; same for both SEQRES and ATOM records:

>d1hxs2_ b.10.1.4 (2:) Poliovirus {Poliovirus type 1, strain Mahoney}
acgysdrvlqltlgnstittqeaansvvaygrwpeylrdseanpvdqptepdvaacrfyt
ldtvswtkesrgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqgalgvf
avpemclagdsntttmhtsyqnanpgekggtftgtftpdnnqtsparrfcpvdyllgngt
llgnafvfphqiinlrtnncatlvlpyvnslsidsmvkhnnwgiailplaplnfasessp
eipitltiapmccefnglrnitlprlq

Timeline for d1hxs2_:

• d1hxs2_ first appeared in SCOP 1.59
  
• d1hxs2_ appears in SCOP 1.61
  
• d1hxs2_ does not appear in SCOP 1.65